{"product_id":"proteintech-26540-1-ap","title":"Proteintech, 26540-1-AP, SLC39A14\/ZIP-14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A14\/ZIP-14 (26540-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A14\/ZIP-14 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26540-1-AP targets SLC39A14\/ZIP-14 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse spleen tissue,  rat heart tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMetal cation symporter ZIP14 (SLC39A14) is an electroneutral transporter of the plasma membrane that mediates the cellular uptake of divalent metal cations zinc, manganese, and iron and is important for tissue homeostasis, metabolism, development and immunity (PubMed:15642354, PubMed:27231142, PubMed:29621230). The molecular weight is around 53-54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24210 Product name: Recombinant human SLC39A14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-152 aa of BC015770 Sequence: GAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVE Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 14\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC015770\nGene Symbol: SLC39A14\/ZIP-14\nGene ID (NCBI): 23516\nRRID: AB_3085879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15043\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989116585,"sku":"26540-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26540-1-ap","provider":"Iright","version":"1.0","type":"link"}