{"product_id":"proteintech-26547-1-ap","title":"Proteintech, 26547-1-AP, KLK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLK4 (26547-1-AP) by Proteintech is a Polyclonal antibody targeting KLK4 in IP, IHC, ELISA applications with reactivity to human samples\n26547-1-AP targets KLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: DU 145 cells\nPositive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24240 Product name: Recombinant human KLK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-114 aa of BC069325 Sequence: LSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLA Predict reactive species\nFull Name: kallikrein-related peptidase 4\nCalculated Molecular Weight: 254 aa, 27 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC069325\nGene Symbol: KLK4\nGene ID (NCBI): 9622\nRRID: AB_2880548\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5K2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869469036713,"sku":"26547-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26547-1-ap","provider":"Iright","version":"1.0","type":"link"}