{"product_id":"proteintech-26557-1-ap","title":"Proteintech, 26557-1-AP, ECT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ECT2 (26557-1-AP) by Proteintech is a Polyclonal antibody targeting ECT2 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n26557-1-AP targets ECT2 in WB, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293T cells,  Calu-1 cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEpithelial cell transforming sequence 2 (Ect2) is a guanine nucleotide exchange factor (GEF) for the Rho family GTPases, Rac1, RhoA and Cdc42. Ect2 catalyzes the exchange of GDP for GTP, thereby activating the Rho GTPases toward their downstream effectors  (PMID: 35069543). The cellular localization of Ect2 is cell cycle dependent. Ect2 is localized predominantly in the nucleus during interphase due to two functional NLS sequences found within its central hinge region.1 At the onset of mitosis, Ect2 is dispersed throughout the cytoplasm where it associates with the mitotic spindle at metaphase, the cleavage furrow during telophase, and the mid-body during cytokinesis (PMID: 35069543). Besides normal cellular activity, ECT2 also participates in malignant transformation, tumor initiation, and metastasis (PMID: 36572949).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24836 Product name: Recombinant human ECT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC112086 Sequence: MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAGKQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRR Predict reactive species\nFull Name: epithelial cell transforming sequence 2 oncogene\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC112086\nGene Symbol: ECT2\nGene ID (NCBI): 1894\nRRID: AB_3669547\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H8V3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887419805865,"sku":"26557-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26557-1-ap","provider":"Iright","version":"1.0","type":"link"}