{"product_id":"proteintech-26559-1-ap","title":"Proteintech, 26559-1-AP, CMTM4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CMTM4 (26559-1-AP) by Proteintech is a Polyclonal antibody targeting CMTM4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26559-1-AP targets CMTM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCMTM4 belongs to the CKLF-like MARVEL transmembrane domain containing (CMTM) family which contain a structurally conserved MAL and related proteins for vesicle trafficking and membrane linking (MARVEL) domain (PMID: 32944388). CMTM4 plays an important role in mediating endothelial barrier function and controlling vascular sprouting (PMID: 30097810). CMTM4 has been reported to be the major regulator of PD-L1 in liver cancer (PMID: 34558800) and play a tumor suppressive role in colorectal cancer (PMID: 31435638).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23648 Product name: Recombinant human CMTM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC093679 Sequence: MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCE Predict reactive species\nFull Name: CKLF-like MARVEL transmembrane domain containing 4\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC093679\nGene Symbol: CMTM4\nGene ID (NCBI): 146223\nRRID: AB_3085882\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZR5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886656180393,"sku":"26559-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26559-1-ap","provider":"Iright","version":"1.0","type":"link"}