{"product_id":"proteintech-26564-1-ap","title":"Proteintech, 26564-1-AP, ABCA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCA1 (26564-1-AP) by Proteintech is a Polyclonal antibody targeting ABCA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26564-1-AP targets ABCA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue\nPositive IHC detected in: rat lung tissue, mouse lung tissue,  rat liver tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABCA, MDR\/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterol efflux pump in the cellular lipid removal pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24118 Product name: Recombinant human ABCA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-272 aa of BC141816 Sequence: GVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPKEKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQEM Predict reactive species\nFull Name: ATP-binding cassette, sub-family A (ABC1), member 1\nCalculated Molecular Weight: 2261 aa, 254 kDa\nObserved Molecular Weight: 250 kDa\nGenBank Accession Number: BC141816\nGene Symbol: ABCA1\nGene ID (NCBI): 19\nRRID: AB_3085884\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95477\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868931477673,"sku":"26564-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26564-1-ap","provider":"Iright","version":"1.0","type":"link"}