{"product_id":"proteintech-26587-1-ap","title":"Proteintech, 26587-1-AP, p70(S6K) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe p70(S6K) (26587-1-AP) by Proteintech is a Polyclonal antibody targeting p70(S6K) in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n26587-1-AP targets p70(S6K) in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  A549 cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPS6KB1(Ribosomal protein S6 kinase beta-1) is also named as STK14A, p70 S6KA and belongs to the S6 kinase subfamily. RPS6KB1 is a major substrate of MTOR and acts as a crucial effector of MTOR signaling pathway. It plays a key role in cell growth and proliferation by regulating INS sensitivity, metabolism, protein synthesis, and cell cycle. RPS6KB1 may play an important role in the progression of HCC and could serve as a potential molecular target for HCC therapy (PMID:22684641). RPS6KB1 is a 70 kDa protein and has 5 isoforms with the calculated molecular mass of 51-59kDa produced by alternative initiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24073 Product name: Recombinant human p70(S6K) protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC053365 Sequence: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEI Predict reactive species\nFull Name: ribosomal protein S6 kinase, 70kDa, polypeptide 1\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 60-75 kDa\nGenBank Accession Number: BC053365\nGene Symbol: p70 S6K\nGene ID (NCBI): 6198\nRRID: AB_2880565\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23443\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869479751849,"sku":"26587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26587-1-ap","provider":"Iright","version":"1.0","type":"link"}