{"product_id":"proteintech-26602-1-ap","title":"Proteintech, 26602-1-AP, GJA5\/Connexin 40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GJA5\/Connexin 40 (26602-1-AP) by Proteintech is a Polyclonal antibody targeting GJA5\/Connexin 40 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n26602-1-AP targets GJA5\/Connexin 40 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nConnexin 40 (Cx40), also known as Gap junction alpha 5 protein (GJA5),  belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Four connexins (Cxs) are expressed in the cardiovascular system (Cx37, Cx40, Cx43, and Cx45) and are involved in the development of the cardiovascular system(PMID: 37331352; PMID: 17922338).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24266 Product name: Recombinant human GJA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 233-341 aa of BC013313 Sequence: KIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDK Predict reactive species\nFull Name: gap junction protein, alpha 5, 40kDa\nCalculated Molecular Weight: 40 kDa\nGenBank Accession Number: BC013313\nGene Symbol: GJA5\nGene ID (NCBI): 2702\nRRID: AB_3669552\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36382\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887651377321,"sku":"26602-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26602-1-ap","provider":"Iright","version":"1.0","type":"link"}