{"product_id":"proteintech-26608-1-ap","title":"Proteintech, 26608-1-AP, LOXL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LOXL1 (26608-1-AP) by Proteintech is a Polyclonal antibody targeting LOXL1 in WB, ELISA applications with reactivity to human samples\n26608-1-AP targets LOXL1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThree LOXL1 variants are seen: a band of 64 kDa matching the predicted full-length form lacking the secretory signal peptide, a band of 67 kDa presumed to be the full-length form with the signal peptide, and a band of 36 kDa matching the cleavage product.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24293 Product name: Recombinant human LOXL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-366 aa of BC015090 Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG Predict reactive species\nFull Name: lysyl oxidase-like 1\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC015090\nGene Symbol: LOXL1\nGene ID (NCBI): 4016\nRRID: AB_2880573\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08397\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869555314857,"sku":"26608-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26608-1-ap","provider":"Iright","version":"1.0","type":"link"}