{"product_id":"proteintech-26644-1-ap","title":"Proteintech, 26644-1-AP, LIN54 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIN54 (26644-1-AP) by Proteintech is a Polyclonal antibody targeting LIN54 in WB, ELISA applications with reactivity to human samples\n26644-1-AP targets LIN54 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIN54 is a component of the LINC\/DREAM complex, an important regulator of cell cycle genes (PMID: 17671431; 19725879). The complex binds to more than 800 promoters in G0 phase and is required for repression of E2F target genes (PMID:17531812). In S phase, the complex binds to the promoters of G2\/M genes whose products are required for mitosis and plays an important role in their cell cycle dependent activation (PMID:17671431). LIN54 has a DNA binding region (CXC-hinge-CXC, CHC domain), which consists of two cysteine-rich (CXC) domains separated by a short spacer. It has been reported that the CHC domain functions as a DNA binding domain, and conserved cysteine residues in two CXC domains are essential for DNA binding (PMID: 22895175). The calculated molecular weight of LIN54 is 79 kDa and an apparent molecular mass of 100-110 kDa has been reported (PMID: 17531812; 28920576; 17671431).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24507 Product name: Recombinant human LIN54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 555-631 aa of BC109278 Sequence: LADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER Predict reactive species\nFull Name: lin-54 homolog (C. elegans)\nCalculated Molecular Weight: 749 aa, 79 kDa\nObserved Molecular Weight: 79 kDa, 100 kDa\nGenBank Accession Number: BC109278\nGene Symbol: LIN54\nGene ID (NCBI): 132660\nRRID: AB_3669558\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6MZP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869703458985,"sku":"26644-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26644-1-ap","provider":"Iright","version":"1.0","type":"link"}