{"product_id":"proteintech-26687-1-ap","title":"Proteintech, 26687-1-AP, BTN1A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BTN1A1 (26687-1-AP) by Proteintech is a Polyclonal antibody targeting BTN1A1 in WB, ELISA applications with reactivity to human samples\n26687-1-AP targets BTN1A1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBTN1A1, also named as Butyrophilin subfamily 1 member A1, is a 526 amino acid protein, which contains 1 B30.2\/SPRY domain and belongs to the immunoglobulin superfamily. BTN\/MOG family. BTN1A1 localizes in the integral component of plasma membrane. BTN1A1 may function in the secretion of milk-fat droplets and may act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. BTN1A1 Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. The calculated molecular weight of BTN1A1 is a 59 kDa, but the modified BTN1A1 protein is about 65-75 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24613 Product name: Recombinant human BTN1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 448-526 aa of BC096312 Sequence: SNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP Predict reactive species\nFull Name: butyrophilin, subfamily 1, member A1\nCalculated Molecular Weight: 526 aa, 59 kDa\nObserved Molecular Weight: 65-75 kDa\nGenBank Accession Number: BC096312\nGene Symbol: BTN1A1\nGene ID (NCBI): 696\nRRID: AB_2880603\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13410\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869644411049,"sku":"26687-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26687-1-ap","provider":"Iright","version":"1.0","type":"link"}