{"product_id":"proteintech-26696-1-ap","title":"Proteintech, 26696-1-AP, BMPR1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BMPR1B (26696-1-AP) by Proteintech is a Polyclonal antibody targeting BMPR1B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26696-1-AP targets BMPR1B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, rat colon tissue\nPositive IHC detected in: rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBMPR1B (Bone morphogenetic protein receptor type-1B) is also named as CDw293. BMPR1B belongs to the protein kinase superfamily. BMPR1B is on ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine\/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. BMPR1B is receptor for BMP7\/OP-1 and GDF5. BMPR1B Positively regulates chondrocyte differentiation through GDF5 interaction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24902 Product name: Recombinant human BMPR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-57 aa of BC047773 Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI Predict reactive species\nFull Name: bone morphogenetic protein receptor, type IB\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC047773\nGene Symbol: BMPR1B\nGene ID (NCBI): 658\nRRID: AB_3085892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00238\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869643362473,"sku":"26696-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26696-1-ap","provider":"Iright","version":"1.0","type":"link"}