{"product_id":"proteintech-26754-1-ap","title":"Proteintech, 26754-1-AP, CENPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CENPA (26754-1-AP) by Proteintech is a Polyclonal antibody targeting CENPA in WB, IHC, ELISA applications with reactivity to human samples\n26754-1-AP targets CENPA in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  Jurkat cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCentromere protein-A (CENP-A) is a Histone H3-like protein that contains a C-terminal H3-like domain, required for centro-mere localization of CENP-A, and an antigenic N-terminal domain. CENP-A, originally isolated from HeLa cells, is essential for kinetochore targeting of CENP-C. In the presence of DNA, CENP-A forms an octameric complex with histones H4, H2A and H2B. CENP-A specifically localizes to active centromeres and is a component of specialized centromeric nucleosomes, on which kinetochores are assembled. CENP-A is essential for nucleosomal packaging of centromeric DNA at interphase and functions as a centromere formation marker on the chromosome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25025 Product name: Recombinant human CENPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC002703 Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH Predict reactive species\nFull Name: centromere protein A\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC002703\nGene Symbol: CENPA\nGene ID (NCBI): 1058\nRRID: AB_2880622\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49450\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869399044265,"sku":"26754-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26754-1-ap","provider":"Iright","version":"1.0","type":"link"}