{"product_id":"proteintech-26756-1-ap","title":"Proteintech, 26756-1-AP, CXCR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCR3 (26756-1-AP) by Proteintech is a Polyclonal antibody targeting CXCR3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26756-1-AP targets CXCR3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  mouse liver tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCR3 (C-X-C chemokine receptor type 3) is a G-protein-coupled seven-transmembrane domain chemokine receptor that is expressed on the surface of a number of cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells. CXCR3 is activated by three related chemokines (CXCL9, CXCL10, and CXCL11) and plays an important role in effector T-cell and NK cell trafficking. CXCR3 has three isoforms termed CXCR3-A, CXCR3-B, and CXCR3-alt with the calculated molecular mass of 41kDa, 46kDa, and 29kDa respectively. The apparent molecular mass of CXCR3 detected by some scientists is 70kDa, but 45kDa by others. (PMID: 16847335, 15150261, 22885102, 19151743)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25056 Product name: Recombinant human CXCR3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-53 aa of BC034403 Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR Predict reactive species\nFull Name: chemokine (C-X-C motif) receptor 3\nCalculated Molecular Weight: 368 aa, 41 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC034403\nGene Symbol: CXCR3\nGene ID (NCBI): 2833\nRRID: AB_2880623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49682\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876066985,"sku":"26756-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26756-1-ap","provider":"Iright","version":"1.0","type":"link"}