{"product_id":"proteintech-26758-1-ap","title":"Proteintech, 26758-1-AP, Cas9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cas9 (26758-1-AP) by Proteintech is a Polyclonal antibody targeting Cas9 in WB, IP, ELISA applications with reactivity to bacteria samples\n26758-1-AP targets Cas9 in WB, IP, ELISA applications and shows reactivity with bacteria samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes. This antibody detects the sp Cas9.This antibody can recognize Cas9 protein with point mutations, such as dCas9 and nCas9.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: bacteria\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25281 Product name: Recombinant Cas9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of NP_269215 Sequence: MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR Predict reactive species\nFull Name: Cas9\nCalculated Molecular Weight: 160 kDa\nGenBank Accession Number: NP_269215\nRRID: AB_2918109\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99ZW2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869449081001,"sku":"26758-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26758-1-ap","provider":"Iright","version":"1.0","type":"link"}