{"product_id":"proteintech-26765-1-ap","title":"Proteintech, 26765-1-AP, mCherry Polyclonal antibody","description":"Size: 150ul\nThe mCherry (26765-1-AP) by Proteintech is a Polyclonal antibody targeting mCherry in WB, IF\/ICC, IP, ELISA applications with reactivity to recombinant protein samples\n26765-1-AP targets mCherry in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected HEK-293 cells, Recombinant protein\nPositive IP detected in: Transfected HEK-293T cells\nPositive IF\/ICC detected in: Transfected HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRed fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived fromDiscosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm).When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.This antibody is a rabbit polyclonal antibody raised against mCherry. It can be used to detect mCherry, dsRed, tdTomato, and mScarlet.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: recombinant protein\nCited Reactivity: human, mouse, rabbit, monkey, zebrafish, yeast, plant, d. punctatus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species\nFull Name: mCherry\nCalculated Molecular Weight: 27 kDa\nRRID: AB_2876881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868827046057,"sku":"26765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26765-1-ap","provider":"Iright","version":"1.0","type":"link"}