{"product_id":"proteintech-26767-1-ap","title":"Proteintech, 26767-1-AP, FCHO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FCHO1 (26767-1-AP) by Proteintech is a Polyclonal antibody targeting FCHO1 in WB, IHC, ELISA applications with reactivity to human samples\n26767-1-AP targets FCHO1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFCHO1 is composed of 889 amino acid residues and contains an N-terminal FES-CIP4 homology (FCH) domain and an evolutionarily conserved C-terminal FCHO homology (FOH) domain. FCHO1 functions in an early step of clathrin-mediated endocytosis. FCHO1 is required for plasma membrane clathrin-coated vesicle (CCV) budding and marked sites of CCV formation (PMID: 20448150).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25291 Product name: Recombinant human FCHO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-180 aa of BC028021 Sequence: ETYSKAMAKLSKLASNGTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQKEMDKAETKTKKAAESLRRSVE Predict reactive species\nFull Name: FCH domain only 1\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC028021\nGene Symbol: FCHO1\nGene ID (NCBI): 23149\nRRID: AB_2880626\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14526\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887637713065,"sku":"26767-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26767-1-ap","provider":"Iright","version":"1.0","type":"link"}