{"product_id":"proteintech-26784-1-ap","title":"Proteintech, 26784-1-AP, GCGR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GCGR (26784-1-AP) by Proteintech is a Polyclonal antibody targeting GCGR in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26784-1-AP targets GCGR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse heart tissue\nPositive IHC detected in: human liver tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucagon receptor (GCGR) is a secretin-like (class B) family of G-protein coupled receptors (GPCRs). It plays an important role in elevating the glucose concentration in the blood and has thus become one of the promising therapeutic targets for treating type 2 diabetes mellitus (PMID: 26236379). GCGR is a 62-kDa glycoprotein that contains at least four N-linked oligosaccharide chains (PMID: 2174441; 15245877). Defects in the gene of GCGR cause non-insulin-dependent diabetes mellitus (NIDDM).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24861 Product name: Recombinant human GCGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-141 aa of BC104854 Sequence: VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSF Predict reactive species\nFull Name: glucagon receptor\nCalculated Molecular Weight: 477 aa, 54 kDa\nObserved Molecular Weight: 62-68 kDa\nGenBank Accession Number: BC104854\nGene Symbol: GCGR\nGene ID (NCBI): 2642\nRRID: AB_2880634\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47871\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868966801577,"sku":"26784-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26784-1-ap","provider":"Iright","version":"1.0","type":"link"}