{"product_id":"proteintech-26796-1-ap","title":"Proteintech, 26796-1-AP, SLC22A7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC22A7 (26796-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A7 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n26796-1-AP targets SLC22A7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOrganic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25217 Product name: Recombinant human SLC22A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-140 aa of BC033805 Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ Predict reactive species\nFull Name: solute carrier family 22 (organic anion transporter), member 7\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC033805\nGene Symbol: SLC22A7\nGene ID (NCBI): 10864\nRRID: AB_2880639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y694\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973682857,"sku":"26796-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26796-1-ap","provider":"Iright","version":"1.0","type":"link"}