{"product_id":"proteintech-26798-1-ap","title":"Proteintech, 26798-1-AP, GPSM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPSM2 (26798-1-AP) by Proteintech is a Polyclonal antibody targeting GPSM2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26798-1-AP targets GPSM2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  HEK-293T cells,  mouse liver tissue,  HEK-293 cells\nPositive IHC detected in: human placenta tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPSM2 belongs to a family of proteins that modulate activation of G proteins. GPSM2 assists in the exchange of guanine nucleotides, and allows extracellular signals to be transmitted to cells via cell surface, and ultimately plays a key role in the activation of G-proteins. Therefore, GPSM2 is a critical factor for the stability of cell division. Some recent studies have shown that GPSM2 messenger RNA (mRNA) is overexpressed and plays a positive role in the development of certain tumors, such as liver cancer, pancreatic cancer, breast cancer. It also plays a role in neuroblast division and in the development of normal hearing. Mutations in GPSM2 are associated with autosomal recessive nonsyndromic deafness (DFNB82), which is a form of non-syndromic deafness characterized by prelingual, bilateral, severe, sensorineural hearing loss.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25195 Product name: Recombinant human GPSM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 559-600 aa of BC027732 Sequence: FSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGS Predict reactive species\nFull Name: G-protein signaling modulator 2 (AGS3-like, C. elegans)\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 70-77 kDa\nGenBank Accession Number: BC027732\nGene Symbol: GPSM2\nGene ID (NCBI): 29899\nRRID: AB_2880640\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P81274\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869546795177,"sku":"26798-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26798-1-ap","provider":"Iright","version":"1.0","type":"link"}