{"product_id":"proteintech-26799-1-ap","title":"Proteintech, 26799-1-AP, SLC39A1\/ZIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A1\/ZIP1 (26799-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A1\/ZIP1 in WB, ELISA applications with reactivity to human samples\n26799-1-AP targets SLC39A1\/ZIP1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC39A1, also known as ZIP1, is a member of the zinc-iron permease family. It is localized to the cell membrane and acts as a zinc uptake transporter. SLC39A1 mediates the influx of Zn2+ into cells from extracellular space(PMID: 16844077).SLC39A1 is the major importer of zinc from circulating blood plasma into prostate cells (PMID: 12888280). In mesenchymal stem cells (MSCs), ZIP1 may exist as a dimer with a molecular weight of 70kD(PMID:16203195).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24937 Product name: Recombinant human SLC39A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-179 aa of BC003152 Sequence: PDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 1\nCalculated Molecular Weight: 324 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC003152\nGene Symbol: SLC39A1\nGene ID (NCBI): 27173\nRRID: AB_3669568\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NY26\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806730409,"sku":"26799-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26799-1-ap","provider":"Iright","version":"1.0","type":"link"}