{"product_id":"proteintech-26804-1-ap","title":"Proteintech, 26804-1-AP, SLC25A12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A12 (26804-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A12 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n26804-1-AP targets SLC25A12 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse kidney tissue,  mouse skeletal muscle tissue,  rat heart tissue\nPositive IHC detected in: human breast cancer tissue, human pancreas cancer tissue,  human stomach cancer tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A12, also known as ARALAR1, is a key component of the malate-aspartate shuttle, a metabolic system that facilitates the transfer of reducing equivalents (NADH) from the cytoplasm into mitochondria, thereby supporting oxidative phosphorylation and ATP production. SLC25A12 dysfunction results in impaired mitochondrial energy production, which can lead to neuronal damage, developmental delays, and myelination defects (PMID: 20015484).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25150 Product name: Recombinant human SLC25A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC016932 Sequence: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVA Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier, Aralar), member 12\nCalculated Molecular Weight: 75 kDa, 63 kDa\nObserved Molecular Weight: ~70 kDa\nGenBank Accession Number: BC016932\nGene Symbol: SLC25A12\nGene ID (NCBI): 8604\nRRID: AB_2880641\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75746\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887804600489,"sku":"26804-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26804-1-ap","provider":"Iright","version":"1.0","type":"link"}