{"product_id":"proteintech-26809-1-ap","title":"Proteintech, 26809-1-AP, BCLAF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCLAF1 (26809-1-AP) by Proteintech is a Polyclonal antibody targeting BCLAF1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26809-1-AP targets BCLAF1 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  MCF-7 cells\nPositive IHC detected in: mouse testis tissue, human colon tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1\/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25210 Product name: Recombinant human BCLAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 881-920 aa of BC132780 Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE Predict reactive species\nFull Name: BCL2-associated transcription factor 1\nCalculated Molecular Weight: 920 aa, 106 kDa\nObserved Molecular Weight: 145 kDa\nGenBank Accession Number: BC132780\nGene Symbol: BCLAF1\nGene ID (NCBI): 9774\nRRID: AB_2880642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYF8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868947468457,"sku":"26809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26809-1-ap","provider":"Iright","version":"1.0","type":"link"}