{"product_id":"proteintech-26829-1-ap","title":"Proteintech, 26829-1-AP, SUSD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUSD4 (26829-1-AP) by Proteintech is a Polyclonal antibody targeting SUSD4 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n26829-1-AP targets SUSD4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, TT cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe SUSD4 (Sushi domain-containing protein 4) gene resides on chromosome 1q41 and encodes a 49-kD transmembrane protein containing four extracellular Sushi domain motifs. The Sushi domain, also known as the complement control protein domain, is commonly involved in protein-protein interactions. Many complement regulators are constructed with complement control protein domains.  SUSD4 functions as a complement system regulator, as it has been shown to bind to the C1 complex and complement component C1q and block the activation of the complement cascade by interrupting the formation of C3 convertase. (PMID: 32179479)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25346 Product name: Recombinant human SUSD4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 42-290 aa of BC004888 Sequence: FGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLF Predict reactive species\nFull Name: sushi domain containing 4\nCalculated Molecular Weight: 490 aa, 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC004888\nGene Symbol: SUSD4\nGene ID (NCBI): 55061\nRRID: AB_3669569\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VX71\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887820001449,"sku":"26829-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26829-1-ap","provider":"Iright","version":"1.0","type":"link"}