{"product_id":"proteintech-26848-1-ap","title":"Proteintech, 26848-1-AP, CRH\/CRF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRH\/CRF (26848-1-AP) by Proteintech is a Polyclonal antibody targeting CRH\/CRF in WB, ELISA applications with reactivity to human, mouse, rat samples\n26848-1-AP targets CRH\/CRF in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRH, also called CRF or corticoliberin, is a peptide hormone and neurotransmitter involved in the stress response. Marked reduction in this protein has been observed in association with Alzheimer disease. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25226 Product name: Recombinant human CRH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-156 aa of BC011031 Sequence: SEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEE Predict reactive species\nFull Name: CRH\/CRF\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC011031\nGene Symbol: CRH\nGene ID (NCBI): 1392\nRRID: AB_3085911\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06850\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869454127273,"sku":"26848-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26848-1-ap","provider":"Iright","version":"1.0","type":"link"}