{"product_id":"proteintech-26860-1-ap","title":"Proteintech, 26860-1-AP, PTPRF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRF (26860-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRF in WB, ELISA applications with reactivity to human samples\n26860-1-AP targets PTPRF in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, MKN-45 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPRF (Protein Tyrosine Phosphatase Receptor Type F) is a receptor protein tyrosine phosphatase, also known as LAR. PTPRF is a transmembrane protein with extracellular domain, transmembrane domain and two intracellular catalytic domains in series. It is located in the cell membrane and participates in the interaction between cells or cell matrix. It is widely expressed in many tissues, including fat, skin, heart, lung, liver, kidney, pancreas, small intestine, colon, brain, skeletal muscle, spleen, peripheral white blood cells and so on. The protein plays an important role in regulating a variety of cell processes, including cell growth, differentiation, mitotic cycle and carcinogenic transformation. In the insulin-responsive tissues of obese and insulin-resistant individuals, the expression level of PTPRF is increased, which may contribute to the pathogenesis of insulin resistance. PTPRF showed expression changes in many cancers, such as breast cancer, thyroid cancer, non-small cell lung cancer and so on. In gastric adenocarcinoma, PTPRF, as a new tumor suppressor, plays a role by inactivating ERK1\/2 signaling pathway (PMID: 32973331). The total length of the protein is 175-200kd, and after cutting, it forms 125-150 and 80-85kd,70 and 72kDa fragments (PMID: 1547787, PMID: 17259169).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25448 Product name: Recombinant human PTPRF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1080-1150 aa of BC048768 Sequence: HLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELEL Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, F\nCalculated Molecular Weight: 1898 aa, 212 kDa\nObserved Molecular Weight: 70-72 kDa, 150 kDa\nGenBank Accession Number: BC048768\nGene Symbol: PTPRF\nGene ID (NCBI): 5792\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10586\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777140905,"sku":"26860-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26860-1-ap","provider":"Iright","version":"1.0","type":"link"}