{"product_id":"proteintech-26864-1-ap","title":"Proteintech, 26864-1-AP, SLC7A11\/xCT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC7A11\/xCT (26864-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A11\/xCT in WB, IHC, IP, ELISA applications with reactivity to human samples\n26864-1-AP targets SLC7A11\/xCT in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled HeLa cells, HeLa cells,  HepG2 cells,  unboiled HepG2 cells\nPositive IP detected in: HeLa cells, A549 cells,  HepG2 cells\nPositive IHC detected in: human renal cell carcinoma tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer. The SLC7A11 protein appears at two molecular weights, 55 kDa and 35 kDa, and the 55 kDa protein is ubiquitinated(PMID: 32188872). 26864-1-AP recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, chicken, bovine, sheep, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25431 Product name: Recombinant human SLC7A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC012087 Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR Predict reactive species\nFull Name: solute carrier family 7, (cationic amino acid transporter, y+ system) member 11\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC012087\nGene Symbol: SLC7A11\nGene ID (NCBI): 23657\nRRID: AB_2880661\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPY5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868818624681,"sku":"26864-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26864-1-ap","provider":"Iright","version":"1.0","type":"link"}