{"product_id":"proteintech-26874-1-ap","title":"Proteintech, 26874-1-AP, SLC35A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC35A3 (26874-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35A3 in WB, ELISA applications with reactivity to human samples\n26874-1-AP targets SLC35A3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC35A3, also named as UDP-N-acetylglucosamine transporter(NGT), is located to the Golgi apparatus. SLC35A3 can form heterologous complexes with SLC35A2(UGT) and Mgats in the Golgi membrane which may promote biosynthesis of complex N-glycans. It has been reported that the mutation of SLC35A3 is associsted with skeletal dysplasia and epilepsies which could result from impaired glycosylation of proteins. SLC35A3 has some isoforms with 32-36 kDa and 41 kDa.(PMID: 25944901, 28777481\n , 16344554, 23583405)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25468 Product name: Recombinant human SLC35A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 158-220 aa of BC005136 Sequence: SDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL Predict reactive species\nFull Name: solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3\nCalculated Molecular Weight: 325 aa, 36 kDa\nObserved Molecular Weight: 32-36 and 41 kDa\nGenBank Accession Number: BC005136\nGene Symbol: SLC35A3\nGene ID (NCBI): 23443\nRRID: AB_2880665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2D2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869765980329,"sku":"26874-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26874-1-ap","provider":"Iright","version":"1.0","type":"link"}