{"product_id":"proteintech-26888-1-ap","title":"Proteintech, 26888-1-AP, SCAMP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCAMP3 (26888-1-AP) by Proteintech is a Polyclonal antibody targeting SCAMP3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n26888-1-AP targets SCAMP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, A549 cells,  K-562 cells\nPositive IP detected in: HepG2 cells, mouse heart tissue\nPositive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25256 Product name: Recombinant human SCAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC000161 Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT Predict reactive species\nFull Name: secretory carrier membrane protein 3\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC000161\nGene Symbol: SCAMP3\nGene ID (NCBI): 10067\nRRID: AB_2810962\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14828\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868960542889,"sku":"26888-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26888-1-ap","provider":"Iright","version":"1.0","type":"link"}