{"product_id":"proteintech-26892-1-ap","title":"Proteintech, 26892-1-AP, GNG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNG3 (26892-1-AP) by Proteintech is a Polyclonal antibody targeting GNG3 in WB, ELISA applications with reactivity to Mouse, Rat samples\n26892-1-AP targets GNG3 in WB, ELISA applications and shows reactivity with Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNG3, also named as GNGT3, belongs to the G protein gamma family. G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins. GNG3 is predominantly expressed in the brain, where its expression increases during postnatal development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25341 Product name: Recombinant human GNG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC015563 Sequence: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma 3\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC015563\nGene Symbol: GNG3\nGene ID (NCBI): 2785\nRRID: AB_3085915\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63215\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653933225,"sku":"26892-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26892-1-ap","provider":"Iright","version":"1.0","type":"link"}