{"product_id":"proteintech-26907-1-ap","title":"Proteintech, 26907-1-AP, AMPK Beta 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMPK Beta 1 (26907-1-AP) by Proteintech is a Polyclonal antibody targeting AMPK Beta 1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26907-1-AP targets AMPK Beta 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Jurkat cells,  NIH\/3T3 cells,  HeLa cells,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine\/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25534 Product name: Recombinant human PRKAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC001056 Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN Predict reactive species\nFull Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC001056\nGene Symbol: PRKAB1\nGene ID (NCBI): 5564\nRRID: AB_2880679\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y478\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869809365161,"sku":"26907-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26907-1-ap","provider":"Iright","version":"1.0","type":"link"}