{"product_id":"proteintech-26915-1-ap","title":"Proteintech, 26915-1-AP, VEGFD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VEGFD (26915-1-AP) by Proteintech is a Polyclonal antibody targeting VEGFD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26915-1-AP targets VEGFD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, MCF-7 cells,  rat heart tissue\nPositive IHC detected in: human lung cancer tissue, human heart tissue,  human thyroid cancer tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVEGFD is a member of the platelet-derived growth factor\/vascular endothelial growth factor (PDGF\/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25552 Product name: Recombinant human FIGF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-128 aa of BC027948 Sequence: AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKST Predict reactive species\nFull Name: c-fos induced growth factor (vascular endothelial growth factor D)\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC027948\nGene Symbol: FIGF\nGene ID (NCBI): 2277\nRRID: AB_2880683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43915\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922171561,"sku":"26915-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26915-1-ap","provider":"Iright","version":"1.0","type":"link"}