{"product_id":"proteintech-26934-1-ap","title":"Proteintech, 26934-1-AP, ANGPTL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANGPTL1 (26934-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26934-1-AP targets ANGPTL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MCF-7 cells,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAngiopoietin-related protein 1 (ANGPTL1) also known as angiopoietin-3 (ANG-3), is a secreted glycoprotein that structurally resembles angiogenin and is involved in the regulation of angiogenesis. ANGPTL1 is down-regulated in various cancers, including colorectal cancer (CRC), and its expression is inversely correlated with metastasis and poor clinical outcomes. ANGPTL1 has been shown to suppress angiogenesis, cancer invasion, metastasis, and cancer progression. The predicted molecular weight of ANGPTL1 is 57 kDa, but the literature reports that the detected molecular weight of ANGPTL1 is around 68 kDa (PMID: 15284220 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25529 Product name: Recombinant human ANGPTL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-315 aa of BC050640 Sequence: ILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDP Predict reactive species\nFull Name: angiopoietin-like 1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC050640\nGene Symbol: ANGPTL1\nGene ID (NCBI): 9068\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95841\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884969840809,"sku":"26934-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26934-1-ap","provider":"Iright","version":"1.0","type":"link"}