{"product_id":"proteintech-26971-1-ap","title":"Proteintech, 26971-1-AP, DNMT3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNMT3B (26971-1-AP) by Proteintech is a Polyclonal antibody targeting DNMT3B in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n26971-1-AP targets DNMT3B in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  MCF-7 cells,  Jurkat cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse brain tissue, human breast cancer tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNMT3B is a DNA-(cytosine C5)-methyltransferase that is responsible for establishing the methylation patterns in cooperation with DNMT3A through the de novo methylation pathway. It is essential for the establishment of DNA methylation patterns during development. DNMT3B contains a C-terminal catalytic domain and an N-terminal regulatory domain, which are involved in targeting chromatin to regulate its function (PMID: 31547729). DNMT3B has 8 isoforms with the molecular mass of 80-96 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25117 Product name: Recombinant human DNMT3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001207055 Sequence: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES Predict reactive species\nFull Name: DNA (cytosine-5-)-methyltransferase 3 beta\nCalculated Molecular Weight: 95 kDa\nObserved Molecular Weight: 85-96 kDa\nGenBank Accession Number: NM_001207055\nGene Symbol: DNMT3B\nGene ID (NCBI): 1789\nRRID: AB_2880705\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBC3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868857651369,"sku":"26971-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26971-1-ap","provider":"Iright","version":"1.0","type":"link"}