{"product_id":"proteintech-26978-1-ap","title":"Proteintech, 26978-1-AP, DCDC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCDC2 (26978-1-AP) by Proteintech is a Polyclonal antibody targeting DCDC2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n26978-1-AP targets DCDC2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse placenta tissue, HepG2 cells\nPositive IHC detected in: human Hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCDC2 (Doublecortin domain-containing protein 2), also known as KIAA1154. DCDC2 is expressed in the central nervous system of adults and fetuses, especially in the olfactory cortex, inferior temporal cortex, medial temporal cortex, hypothalamus, amygdala and hippocampus. DCDCDC2 protein contains two dicortical protein domains that bind to microtubules and enhance microtubule polymerization, which may play a role in neuronal migration and affect the signal transduction of primary cilia. In addition, DCDC2 also plays a role in inhibiting classical WNT signaling. DCDC2 may affect the development and function of the brain by affecting the migration of neurons and the signal conduction of primary cilia, and then it is related to reading ability (PMID: 21457949). The molecular weight of DCDC2 is 52 kDa, it also has another isoform with a molecular weight of 25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25577 Product name: Recombinant human DCDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-476 aa of BC050704 Sequence: EDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA Predict reactive species\nFull Name: doublecortin domain containing 2\nCalculated Molecular Weight: 476 aa, 53 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC050704\nGene Symbol: DCDC2\nGene ID (NCBI): 51473\nRRID: AB_2880709\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHG0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869456027817,"sku":"26978-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26978-1-ap","provider":"Iright","version":"1.0","type":"link"}