{"product_id":"proteintech-26979-1-ap","title":"Proteintech, 26979-1-AP, Cystatin S Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cystatin S (26979-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin S in WB, IHC, ELISA applications with reactivity to human samples\n26979-1-AP targets Cystatin S in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCystatins are a family of inhibitors of cysteine peptidases that comprises the salivary cystatins D and S-type (including CST5 and CST4,1,2) and cystatin C-type (CST3) (PMID: 25329717). The D and S-type cystatin have also been detected in seminal plasma, tears, and tracheobronchial fluid but not in other fluids and secretions where cystatin C is found. And the CST4 was expressed in the serous acinar and demilune cells of the human submandibular gland and at lower levels in the serous acini of the parotid gland (PMID:11879580). CST4 specifically combines with cysteine protease to regulate its activity, thus preventing hydrolysis of the extracellular matrix. And some studies propose that CST4 might be a biomarker for gastrointestinal cancer (PMID:29218251; PMID:29636621).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25619 Product name: Recombinant human CST4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-141 aa of BC065714 Sequence: TCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA Predict reactive species\nFull Name: cystatin S\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC065714\nGene Symbol: Cystatin S\nGene ID (NCBI): 1472\nRRID: AB_2880710\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01036\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869670232233,"sku":"26979-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26979-1-ap","provider":"Iright","version":"1.0","type":"link"}