{"product_id":"proteintech-26984-1-ap","title":"Proteintech, 26984-1-AP, Collagen Type X Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Collagen Type X (26984-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type X in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26984-1-AP targets Collagen Type X in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, ROS1728 cells,  HCT 116 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCollagen type X alpha 1 (COL10A1), a secreted, short-chain collagen, belongs to the collagen family, which is a major interstitial matrix component specifically expressed by hypertrophic chondrocytes. COL10A1 expression is elevated in many solid tumor types, such as colon cancer, esophagus cancer, and breast cancer, and displays vital roles in many critical cellular processes (PMID: 30154451,  25321476).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25741 Product name: Recombinant human COL10A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 518-585 aa of BC130621 Sequence: QAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPR Predict reactive species\nFull Name: collagen, type X, alpha 1\nCalculated Molecular Weight: 680 aa, 66 kDa\nObserved Molecular Weight: 60-66 kDa\nGenBank Accession Number: BC130621\nGene Symbol: COL10A1\nGene ID (NCBI): 1300\nRRID: AB_3085918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03692\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939833513,"sku":"26984-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26984-1-ap","provider":"Iright","version":"1.0","type":"link"}