{"product_id":"proteintech-26989-1-ap","title":"Proteintech, 26989-1-AP, RRAGC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RRAGC (26989-1-AP) by Proteintech is a Polyclonal antibody targeting RRAGC in WB, ELISA applications with reactivity to human, mouse samples\n26989-1-AP targets RRAGC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  NIH\/3T3 cells,  HEK-293T cells,  HeLa cells,  K-562 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRRAGC (Ras-related GTP-binding protein C) is a small monomeric GTPase that functions as part of the mTORC1 nutrient-sensing pathway. Together with its dimerization partners RRAGA or RRAGB, RRAGC localizes mainly to the cytoplasm and, in response to amino-acid availability, recruits the mTORC1 complex to the lysosomal surface where mTORC1 can be activated by Rheb. This makes RRAGC a key molecular switch linking cellular metabolic state to growth control.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25780 Product name: Recombinant human RRAGC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC016668 Sequence: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGP Predict reactive species\nFull Name: Ras-related GTP binding C\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC016668\nGene Symbol: RRAGC\nGene ID (NCBI): 64121\nRRID: AB_2880714\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HB90\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009531049,"sku":"26989-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26989-1-ap","provider":"Iright","version":"1.0","type":"link"}