{"product_id":"proteintech-26994-1-ap","title":"Proteintech, 26994-1-AP, TCTEX1D2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCTEX1D2 (26994-1-AP) by Proteintech is a Polyclonal antibody targeting TCTEX1D2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26994-1-AP targets TCTEX1D2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDYNLT2B also known as TCTEX1D2, belongs to the dynein family and is required for proper retrograde ciliary transport(PMID: 29742051). TCTEX1D2 functions as a light chain that appears to stabilize the retrograde IFT dynein complex. Mutations in TCTEX1D2 are associated with Short-rib thoracic dysplasia 17 with or without polydactyly (SRTD17)( PMID: 26044572).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25770 Product name: Recombinant human TCTEX1D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC021177 Sequence: MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEGLANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY Predict reactive species\nFull Name: Tctex1 domain containing 2\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC021177\nGene Symbol: TCTEX1D2\nGene ID (NCBI): 255758\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WW35\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887825309865,"sku":"26994-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26994-1-ap","provider":"Iright","version":"1.0","type":"link"}