{"product_id":"proteintech-26995-1-ap","title":"Proteintech, 26995-1-AP, WFS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WFS1 (26995-1-AP) by Proteintech is a Polyclonal antibody targeting WFS1 in IHC, IF\/ICC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n26995-1-AP targets WFS1 in WB, IHC, IF\/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: rat brain tissue, mouse brain tissue,  mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue, mouse brain tissue\nPositive IF-Fro detected in: rat brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWolfram syndrome protein (WFS1), also called wolframin, is a transmembrane protein, which is located primarily in the endoplasmic reticulum and its expression is induced in response to ER stress, partially through transcriptional activation. ER localization suggests that WFS1 protein has physiological functions in membrane trafficking, secretion, processing and\/or regulation of ER calcium homeostasis. It is ubiquitously expressed with highest levels in brain, pancreas, heart, and insulinoma beta-cell lines. Mutations of the WFS1 gene are responsible for two hereditary diseases, autosomal recessive Wolfram syndrome and autosomal dominant low frequency sensorineural hearing loss. Wolframin assembles into higher molecular weight complexes of approximately 400 kDa in the membrane(PMID: 12913071)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25724 Product name: Recombinant human WFS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC030130 Sequence: MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERA Predict reactive species\nFull Name: Wolfram syndrome 1 (wolframin)\nCalculated Molecular Weight: 890 aa, 100 kDa\nGenBank Accession Number: BC030130\nGene Symbol: WFS1\nGene ID (NCBI): 7466\nRRID: AB_2880717\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76024\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872855721,"sku":"26995-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26995-1-ap","provider":"Iright","version":"1.0","type":"link"}