{"product_id":"proteintech-26997-1-ap","title":"Proteintech, 26997-1-AP, RASGRP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RASGRP1 (26997-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRP1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26997-1-AP targets RASGRP1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRASGRP1 (RAS guanyl-releasing protein 1) is a Ras guanine nucleotide exchange factor, and an essential regulator of lymphocyte receptor signaling (PMID: 33065764). RasGRP1 is a bifunctional regulator that promotes acute inflammation and inhibits inflammation-associated cancer (PMID: 36385095). RasGRP1, a downstream target gene of VEGF, regulates the development, homeostasis, and differentiation of T cells (PMID: 37429143).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25725 Product name: Recombinant human RASGRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 678-797 aa of BC109297 Sequence: QPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS Predict reactive species\nFull Name: RAS guanyl releasing protein 1 (calcium and DAG-regulated)\nCalculated Molecular Weight: 797 aa, 90 kDa\nObserved Molecular Weight: 85-90 kDa\nGenBank Accession Number: BC109297\nGene Symbol: RASGRP1\nGene ID (NCBI): 10125\nRRID: AB_3669579\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95267\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887779696809,"sku":"26997-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-26997-1-ap","provider":"Iright","version":"1.0","type":"link"}