{"product_id":"proteintech-27004-1-ap","title":"Proteintech, 27004-1-AP, NUDT5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUDT5 (27004-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27004-1-AP targets NUDT5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells,  MCF-7 cels,  MDA-MB-231 cells,  T-47D cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUDT5 (NUDIX hydrolase type 5), also called NUDIX5, is a member of the nudix hydrolase family which eliminate toxic nucleotide derivatives from the cell. NUDT5 expression can affect chromosome remodeling, involved in cell adhesion, cancer stem cell maintenance and epithelial to mesenchyme transition in breast cancer cells. In addtion, the high expression of NUDT5 is probably involved in the poor prognosis of breast cancer, which could be a prognostic factor and potential target in the diagnosis and treatment of breast cancer (PMID: 33571243). This NUDT5 protein can be detected with a molecular weight of 35 kDa (PMID: 33096144).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25485 Product name: Recombinant human NUDT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC000025 Sequence: MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF Predict reactive species\nFull Name: nudix (nucleoside diphosphate linked moiety X)-type motif 5\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC000025\nGene Symbol: NUDT5\nGene ID (NCBI): 11164\nRRID: AB_3085919\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKK9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869721546921,"sku":"27004-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27004-1-ap","provider":"Iright","version":"1.0","type":"link"}