{"product_id":"proteintech-27011-1-ap","title":"Proteintech, 27011-1-AP, PEX12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PEX12 (27011-1-AP) by Proteintech is a Polyclonal antibody targeting PEX12 in WB, ELISA applications with reactivity to human samples\n27011-1-AP targets PEX12 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  A549 cells,  HeLa cells,  HepG2 cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxisome assembly protein 12 (PEX12), also known as Peroxisome assembly factor 3 (PAF-3), is an integral peroxisomal membrane protein that is essential for peroxisomal matrix protein import and is one of only two peroxins known to interact with the ligand-binding domain of PEX5. Mutations in human PEX12 result in Zellweger syndrome, a lethal neurological disorder, and implicate the zinc ring domain in PEX12 function (PMID: 12456682). Pex12 exhibits protein-Ub ligase activity with specificity for the E2 protein Pex4 and Ubc4 (PMID: 19687296).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25500 Product name: Recombinant human PEX12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC031085 Sequence: MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKR Predict reactive species\nFull Name: peroxisomal biogenesis factor 12\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 40-42 kDa\nGenBank Accession Number: BC031085\nGene Symbol: PEX12\nGene ID (NCBI): 5193\nRRID: AB_2880720\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00623\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869482307753,"sku":"27011-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27011-1-ap","provider":"Iright","version":"1.0","type":"link"}