{"product_id":"proteintech-27012-1-ap","title":"Proteintech, 27012-1-AP, MKX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MKX (27012-1-AP) by Proteintech is a Polyclonal antibody targeting MKX in WB, ELISA applications with reactivity to human samples\n27012-1-AP targets MKX in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMohawk (Mkx) is a member of the Three Amino Acid Loop Extension (TALE) superclass of atypical homeobox genes. It encodes a transcriptional repressor that is expressed in the embryonic precursors of skeletal muscle, tendon, cartilage, and bone. This gene is highly conserved across species and is known to be involved in the differentiation and maintenance of these tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25549 Product name: Recombinant human MKX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-352 aa of BC036207 Sequence: GVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTDTLENGSNKGESAANRKGPSKDDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQQF Predict reactive species\nFull Name: mohawk homeobox\nCalculated Molecular Weight: 352 aa, 39 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC036207\nGene Symbol: MKX\nGene ID (NCBI): 283078\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYA7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887720190121,"sku":"27012-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27012-1-ap","provider":"Iright","version":"1.0","type":"link"}