{"product_id":"proteintech-27018-1-ap","title":"Proteintech, 27018-1-AP, RNF113A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF113A (27018-1-AP) by Proteintech is a Polyclonal antibody targeting RNF113A in WB, IHC, ELISA applications with reactivity to human samples\n27018-1-AP targets RNF113A in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, MCF-7 cells,  HEK-293T cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25313 Product name: Recombinant human RNF113A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-100 aa of BC000832 Sequence: GESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVY Predict reactive species\nFull Name: ring finger protein 113A\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC000832\nGene Symbol: RNF113A\nGene ID (NCBI): 7737\nRRID: AB_2880724\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15541\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869587624105,"sku":"27018-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27018-1-ap","provider":"Iright","version":"1.0","type":"link"}