{"product_id":"proteintech-27035-1-ap","title":"Proteintech, 27035-1-AP, PI3 Kinase p55 Gamma Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PI3 Kinase p55 Gamma (27035-1-AP) by Proteintech is a Polyclonal antibody targeting PI3 Kinase p55 Gamma in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27035-1-AP targets PI3 Kinase p55 Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HUVEC cells,  HEK-293 cells\nPositive IHC detected in: human kidney tissue, mouse testis tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIK3R3, also named as p55PIK, belongs to the PI3K p85 subunit family. It binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During INS stimulation, it also binds to IRS-1. It is a component of a heterodimer of p110 (catalytic) and p55 (regulatory) subunits. The antibody is specific to PIK3R3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25884 Product name: Recombinant human PIK3R3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 312-382 aa of BC021622 Sequence: HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI Predict reactive species\nFull Name: phosphoinositide-3-kinase, regulatory subunit 3 (gamma)\nCalculated Molecular Weight: 85 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC021622\nGene Symbol: PI3 Kinase p55 Gamma\nGene ID (NCBI): 8503\nRRID: AB_2880730\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92569\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869007073449,"sku":"27035-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27035-1-ap","provider":"Iright","version":"1.0","type":"link"}