{"product_id":"proteintech-27044-1-ap","title":"Proteintech, 27044-1-AP, EMR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EMR1 (27044-1-AP) by Proteintech is a Polyclonal antibody targeting EMR1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27044-1-AP targets EMR1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled RAW 264.7 cells, HL-60 cells\nPositive IHC detected in: mouse spleen tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: mouse peritoneal macrophages\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEMR1 (EGF-like module containing mucin-like hormone receptor 1), also known as Adhesion G protein-coupled receptor E1 (ADGRE1), is a surface receptor with seven transmembrane segments that belong to the EGF-7-transmembrane family of G protein-coupled receptors (PMID: 14647991, 7601460). EMR1 expression is restricted to eosinophilic granulocytes, where expression is overlapping with the eotaxin receptor CCR3 and the immunoglobulin-like lectin Siglec-8. Absence on other leukocytes, including basophils, implies that EMR1 is a highly specific marker for eosinophils in humans and may be used as a novel therapeutic target for eosinophilic disorders (PMID: 17823986, 24530099). F4\/80, the murine homolog of EMR1, is a marker of murine macrophage. The apparent molecular weight of F4\/80 is 160 kDa, which is larger than the calculated molecular weight due to post-translational modifications (PMID: 7308288; 8647179).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25883 Product name: Recombinant human EMR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-510 aa of BC059395 Sequence: TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK Predict reactive species\nFull Name: egf-like module containing, mucin-like, hormone receptor-like 1\nCalculated Molecular Weight: 886 aa, 97 kDa\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: BC059395\nGene Symbol: EMR1\nGene ID (NCBI): 2015\nRRID: AB_2716814\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14246\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852015273,"sku":"27044-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27044-1-ap","provider":"Iright","version":"1.0","type":"link"}