{"product_id":"proteintech-27057-1-ap","title":"Proteintech, 27057-1-AP, XAF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XAF1 (27057-1-AP) by Proteintech is a Polyclonal antibody targeting XAF1 in WB, IP, ELISA applications with reactivity to human samples\n27057-1-AP targets XAF1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, IFN alpha treated treated Jurkat cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXIAP-associated factor 1 (XAF1) is also named as BIRC4BP (BIRC4-binding protein) and XIAPAF1. XAF1 was originally identified as an antagonist of XIAP counteracting its anti-caspase activity by inhibiting the RING domain of XIAP. XAF1is also concerned with IFN-induced apoptosis (PMID: 35972291). XAF1 plays a key role in the communication between IRF1-mediated early immune responses and IRF3-mediated late IFN-dependent immune responses (PMID: 37595039). XAF1 as a direct interacting protein of AKT1,  which strongly binds the N-terminal region of AKT1 to block its K63-linked poly-ubiquitination and subsequent activation (PMID: 37384528). XAF1 may serve as an osteoprotective regulator to restore bone homeostasis (PMID: 38957269).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25843 Product name: Recombinant human XAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-301 aa of BC073156 Sequence: PRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS Predict reactive species\nFull Name: XIAP associated factor 1\nCalculated Molecular Weight: 301 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC073156\nGene Symbol: XAF1\nGene ID (NCBI): 54739\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6GPH4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887924531369,"sku":"27057-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27057-1-ap","provider":"Iright","version":"1.0","type":"link"}