{"product_id":"proteintech-27100-1-ap","title":"Proteintech, 27100-1-AP, FGF3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF3 (27100-1-AP) by Proteintech is a Polyclonal antibody targeting FGF3 in IHC, ELISA applications with reactivity to human samples\n27100-1-AP targets FGF3 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibroblast growth factor 3 (FGF3), belonging to the family of fibroblast growth factors (FGFs), It regulates several developmental processes, including brain patterning, branching morphogenesis and limb development, by binding, dimerizing and activating cell surface FGF receptors (FGFRs). It is required for normal ear development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25361 Product name: Recombinant human FGF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 173-239 aa of BC113739 Sequence: QKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH Predict reactive species\nFull Name: fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog)\nGenBank Accession Number: BC113739\nGene Symbol: FGF3\nGene ID (NCBI): 2248\nRRID: AB_2880755\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11487\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887638925481,"sku":"27100-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27100-1-ap","provider":"Iright","version":"1.0","type":"link"}