{"product_id":"proteintech-27123-1-ap","title":"Proteintech, 27123-1-AP, DMXL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DMXL2 (27123-1-AP) by Proteintech is a Polyclonal antibody targeting DMXL2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27123-1-AP targets DMXL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  MCF-7 cells,  mouse brain tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDMXL2, also named as rabconnectin-3, is a functional regulator of mammalian notch signaling with WD domains. Rabconnectin-3 is abundantly expressed in the brain where it is enriched in the synaptic vesicle fraction. Immunofluorescence and immunoelectron microscopy revealed that rabconnectin-3 was concentrated on synaptic vesicles at synapses. It may serve as a scaffold molecule for both Rab3 GEP and GAP on synaptic vesicles.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25953 Product name: Recombinant human DMXL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1853-2040 aa of BC140781 Sequence: RNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTPQEEDDPEGDTEVDVIAE Predict reactive species\nFull Name: Dmx-like 2\nCalculated Molecular Weight: 3036 aa, 340 kDa\nObserved Molecular Weight: 340 kDa\nGenBank Accession Number: BC140781\nGene Symbol: DMXL2\nGene ID (NCBI): 23312\nRRID: AB_3085927\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDJ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887239057577,"sku":"27123-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27123-1-ap","provider":"Iright","version":"1.0","type":"link"}