{"product_id":"proteintech-27138-1-ap","title":"Proteintech, 27138-1-AP, FCGR2A \/ CD32a Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FCGR2A \/ CD32a (27138-1-AP) by Proteintech is a Polyclonal antibody targeting FCGR2A \/ CD32a in WB, IHC, ELISA applications with reactivity to human samples\n27138-1-AP targets FCGR2A \/ CD32a in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, Raji cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIgG Fc receptors (FcγRs) play important roles in immune responses. Low affinity IgG Fc receptor Fc gamma RIIa (FCGR2A, CD32a) is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25878 Product name: Recombinant human FCGR2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-215 aa of BC020823 Sequence: LEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPM Predict reactive species\nFull Name: Fc fragment of IgG, low affinity IIa, receptor (CD32)\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC020823\nGene Symbol: CD32a\nGene ID (NCBI): 2212\nRRID: AB_2880770\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12318\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887637647529,"sku":"27138-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27138-1-ap","provider":"Iright","version":"1.0","type":"link"}